PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00165g05007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 736aa    MW: 81125.3 Da    PI: 7.205
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00165g05007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-094444811954
                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Niben101Scf00165g05007.1 444 FEHflHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVR 481
                               554459******************************88 PP

2BELL119.71.4e-38305376172
                      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               +rqelq+kkakL+s+l+eV++rY+qy++q+q++++sFe++ag+gsak+Yt+lAl++iS++FrcLkdai++qi
  Niben101Scf00165g05007.1 305 QRQELQMKKAKLISMLDEVEQRYRQYHHQMQIIVASFEEAAGIGSAKSYTQLALHTISKQFRCLKDAITGQI 376
                               69*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.8E-58226374IPR006563POX domain
PfamPF075261.8E-47233373IPR006563POX domain
PROSITE profilePS5007112.05422485IPR001356Homeobox domain
SMARTSM003894.2E-10425489IPR001356Homeobox domain
CDDcd000863.54E-12425486No hitNo description
SuperFamilySSF466895.56E-17426492IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-29428491IPR009057Homeodomain-like
PfamPF059202.9E-18442481IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 736 aa     Download sequence    Send to blast
MAMYYQGSSE IQADGLQTLY LMNPNYIGYT DTQQQQQQQQ QQHLQQANMF FLNSETAGNL  60
PHGQISSQLH AQHFVGVPLQ TSFQDPTRPT VHEVSASHHG LLHRLWSSNG QNSGGSGGGG  120
GNESQSHIPS AVVSPNSVGG TTTDFASQLG FQRPGLVSPA QQHQGLSLSL SPQQQQQQQM  180
INFRSFPLDH HEISPHNNHQ VGILSSSSPR TNTNNDHIRG SGASSSSFSN GMIVGSKYLK  240
AAQELLDEVV NVGKSIKEVG AKEKDKLLDN ELMPLSSDVA AAAPTSGSGE SSSQKNSVPE  300
LTTVQRQELQ MKKAKLISML DEVEQRYRQY HHQMQIIVAS FEEAAGIGSA KSYTQLALHT  360
ISKQFRCLKD AITGQIKATS KSLGEEEINL GGKIEGSSSR LRFVDHHLRQ QRALQQLGMM  420
QPNAWRPQRG LPERAVSVLR AWLFEHFLHP YPKDSDKIML AKQTGLTRSQ VSNWFINARV  480
RLWKPMVEEM YLEEVKNNQE QNGLLEENAK KNNEPNKEMC TKSSAPQETP NPRKDKQISS  540
ILQDASPTEI SSSTISTSPT GGSFPAQAAG FSFIGSLNME NSTSERNNKK ARNDMQNSSS  600
SILSMETEIK AGDTIKGGKF NGDNRQARDQ SYPLMTAYST MGEFGRFNPE QQMATSFQGN  660
GVSLTLGLPP SENLVLSGSQ HNFLPSQNIG IEMGRIETHY NIMSNPQPSH PNINYENIDF  720
QSGKRYAAQL LPDFVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16431489563Homeobox protein Meis2
3k2a_B3e-16431489563Homeobox protein Meis2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1529536PNPRKDKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778871.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009778870.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009778869.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478052.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478051.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478049.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLM1BQG30.0M1BQG3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000505270.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.32e-93BEL1-like homeodomain 1